PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN33725.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 662aa    MW: 72879.1 Da    PI: 6.3708
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN33725.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-094114481954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  KHN33725.1 411 FEHflHPYPKDSDKIMLARQTGLTRSQVSNWFINARVR 448
                 664459******************************88 PP

2BELL122.81.4e-39274345172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 e+q+l+ k +kLls+l+eVd+rYkqy++q+qtv+ssF+++ag+g+akpYt+lAl++iS hFrcL+dai++qi
  KHN33725.1 274 EKQDLHHKLTKLLSMLDEVDNRYKQYYQQMQTVVSSFDVIAGCGAAKPYTALALQTISCHFRCLRDAITGQI 345
                 6799*******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.3E-52192343IPR006563POX domain
PfamPF075261.3E-47198342IPR006563POX domain
PROSITE profilePS5007112.163389452IPR001356Homeobox domain
SMARTSM003896.5E-10392456IPR001356Homeobox domain
CDDcd000864.26E-13392453No hitNo description
SuperFamilySSF466891.92E-17393459IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.6E-29395458IPR009057Homeodomain-like
PfamPF059204.5E-18409448IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MATYYTSSSN ERNAVPMLCL REPLPNSYPE TPVLPSNMTF YMNSGSYSEA LSGNSQQQNN  60
CFVIPSPSVG ASHSTPEQQE IFANISGFQT GFHDFSAWRE GRSEMLVRQP MDGQNLQGHG  120
LSLSLGTHIP SGIHSSSFDS FLGTNPSISG NEAYQNDSSR DEGMRHSENL PPGLPEANQD  180
LAKADFSFHG MSGVGKTVPS SKYLKTVQLL LDEVVDIRKA IKRPAMKSHS THEKSKKDSK  240
EDDEQLENDR PSANGVPNSQ ASTGKTSCEL SHAEKQDLHH KLTKLLSMLD EVDNRYKQYY  300
QQMQTVVSSF DVIAGCGAAK PYTALALQTI SCHFRCLRDA ITGQISATQK NLGEQDASGS  360
NNGVGMARLK YVDQQIRQQR VIQQFGMMQH AWRPQRGLPE SSVSILRAWL FEHFLHPYPK  420
DSDKIMLARQ TGLTRSQVSN WFINARVRLW KPMIEEMYKQ DNCIAGMDSN SSSENVSKVT  480
KSYVKTSNDV GDDSQHCQSP IVTDTNHSGG QAKDLRHDQA LDTEMMASIG LASLINGGYG  540
AETEHRRNLD DCGLFSNDTV VQSDGATNKR FVSVGPTCQM PESERFKSGS GVSLTLGLQH  600
CEGGNFLPGK THLSLVSMRE DDISKATAAS TVGVETTELE CIGAGNQQQR LNSPHMLHDF  660
EV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A5e-17398455158Homeobox protein Meis1
4xrs_B5e-17398455158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006577910.10.0PREDICTED: BEL1-like homeodomain protein 6
RefseqXP_006577911.10.0PREDICTED: BEL1-like homeodomain protein 6
RefseqXP_006577912.10.0PREDICTED: BEL1-like homeodomain protein 6
TrEMBLA0A0B2RKJ00.0A0A0B2RKJ0_GLYSO; BEL1-like homeodomain protein 6
STRINGGLYMA04G01151.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21463179
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-126BEL1-like homeodomain 6
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]